PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010536021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 609aa    MW: 68498.1 Da    PI: 10.5875
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010536021.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.85.8e-091141232
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmg 32
                     g WTt E++llv avk++G+++W+++a+++ 
   XP_010536021.1 11 GQWTTLEELLLVFAVKRHGSRNWDAVAKELH 41
                     78**************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-7547IPR009057Homeodomain-like
SuperFamilySSF466892.5E-6547IPR009057Homeodomain-like
PROSITE profilePS500906.504569IPR017877Myb-like domain
PfamPF002491.6E-71143IPR001005SANT/Myb domain
CDDcd001671.42E-41350No hitNo description
SMARTSM002971.8E-14313422IPR001487Bromodomain
SuperFamilySSF473707.85E-18322419IPR001487Bromodomain
Gene3DG3DSA:1.20.920.108.6E-16322421IPR001487Bromodomain
CDDcd043692.82E-16322417No hitNo description
PfamPF004398.3E-11326406IPR001487Bromodomain
PROSITE profilePS5001412.237332403IPR001487Bromodomain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 609 aa     Download sequence    Send to blast
MAKKHEPKPP GQWTTLEELL LVFAVKRHGS RNWDAVAKEL HSRVAMQRNY VSPSVISPET  60
CRDEFLRLRR RFAAETTADE EEAFLDPMLD EFRRIRIEEL HREVKRHDVS IVLLESKIKR  120
LKEERARSLT EETDLQGRAL EKGETRPSPA TITGKLFAGD EPNGRSSDES VPTEHNPELA  180
MASRDAENDA VNERKSASKN EPEGKTGTIP INPLTEPVRD RGSSPRFTRN TDNGEDKGDG  240
GEAGAAVTRA GPLGESGELS ESKRDAASSS KQSSDVQSLA ILSRRKCRRV PGRGTSSDEE  300
EVDKEEISPA ATKKISAVKP PESMVNLLRR IRSHRLGSAF ERRLRIQESD RYRRVIKQHM  360
DLRTVKSRLD RGAYSEDSRK FYRDLLLLFN NTIVFYRRTS TEHAAAVELR ALVTKEMKLR  420
LRYRSLNPKT SKPFIAPCGK SSSVKKKPEN REVNRGNGSL AAGLKGKKEI SSNHSNQSNN  480
KKGNHTNEKT KKNEFGKNEI SSNDAPMIKS VDVKKKEVRK KEGAEKFLRR MKQDSSTESD  540
EEEEEEEVKE MNKKTKNKKK ATTSCTGGRV KEENMKGKKT AGKVAGKRGR ESKGEGSGGG  600
GRGRKRTRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010536021.10.0PREDICTED: uncharacterized protein LOC104811121 isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1708978
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44430.15e-43DNA-binding bromodomain-containing protein